List Quality Check

You have no lists. To create a list click here

Select Page
Icon

Sender Score

Results for IP address
12.34.56.789

Sender Score

You have an "ok" reputation, but there's room for improvement. Continue to follow industry best practices and optimize your email program.

Sender Metrics

Hostname
-
Volume Sender Class   
-
Certified by Validity   
Return Path Safe   
Reputation Measures
Measure Impact on this score
  Blocklists LOW
  Complaints LOW
  Infrastructure LOW
  ISP Bulk Rate Contact us for details
  Message Filtered LOW
  Sender Rejected LOW
  Spam Traps 2
  Unknown Users LOW
Sending Domains
Domain
EUR04-HE1-obe.outbound.protection.outlook.com
drchoibraces.qfvorlmbizonfbhvtsosekeyybsczxnydmaj.noabii
smtp11.digitalmailer.com
trueccu.com
dovinoss.store
lax101.relay.arandomserver.com
newhcu.org
dgdfgfdgdfgdtreyrtytutyuyuifrtssfdsvgxcvxcv.ggtfdr
cuncambias.org
edelivery.bloomcu.org
GBR01-CWX-obe.outbound.protection.outlook.com
apgfcu.com
soundcu.com
edelivery.hartfordfcu.com
bankcfcu.org
EUR03-AM7-obe.outbound.protection.outlook.com
NAM10-MW2-obe.outbound.protection.outlook.com
cjfcu.org
abcofcu.org
cuadvantage.coop
toplinecu.com
bvepghvhfwdffdzhfaseokdlmzbauigicojbc.hxdmubx
firstamerican.org
NAM10-BN7-obe.outbound.protection.outlook.com
ebilssrxpammwwowcattcxvrmkaoxsldetdjw.xwkyhlb
mout3.freenet.de
DEU01-BE0-obe.outbound.protection.outlook.com
shellfcu.org
fortunevapes.com
lsfeguefphybbsazfvyiwjhaafflposdutsgi.lyfteh
pscunow.com
worcestercu.com
firstcoastccu.com
gcfcu.org
NAM10-DM6-obe.outbound.protection.outlook.com
NAM12-MW2-obe.outbound.protection.outlook.com
a1cu.org
dal030.relay.arandomserver.com
edelivery.nextmarkcu.org
ireland-bank.com
localhost.members.linode.com
nefcu.com
NAM11-DM6-obe.outbound.protection.outlook.com
hncu.org
signaturefcu.org
uecu.org
docfcu.org
merckefcu.com
nextmarkcu.org
dimercont.store
members.leadersemail.com
nymeo.org
prod-wheat-hummingbird.itisonboxes.com
tandsgo2.backslash.host
unitedlocal.org
westcommunitycu.org
ywpkziptjjnsyjpnhxitiiawpwyeimbduplwd.vowmko
edelivery.docfcu.org
ffcocu.org
mail1.euroasiaconferences.com
pahowhofcu.org
visionsfcu.org
mystatement.org
pyramidfcu.org
thevalleyreviews.net
elgacu.com
OS5P279CU001.outbound.protection.outlook.com
a14-94.smtp-out.amazonses.com
atfcu.com
fsbwa.com
lvyhroocxizgdchsbplloxlbkaueqhstcycfzltr.rcgpd
safewayfcu.com
vmi1690196.contaboserver.net
waunafcu.org
wordnow.online
mout1.freenet.de
qmvnrtrvffqnoqdjrfiiadjfzlvjgtopvwqyg.rigjepg
regionalfcu.org
vawhptieyymvmnsbtucxwzjwdlbcgrdjefzx.owlybc
NAM04-MW2-obe.outbound.protection.outlook.com
NAM11-CO1-obe.outbound.protection.outlook.com
americanspiritfcu.org
ystlhtluuhiaautxqwnocsrcwxnqoaftdzbhy.bctrxio
advfinfcu.com
bunting.drbellem.store
ny021.relay.arandomserver.com
triuneservicesgroup.net
ueluymbwouvoysbjvoncoheodqboessfvmenz.zvglemh
ukfcu.org
smtp12.digitalmailer.com
ezbhxilcksphwttgafmwcwctkegkfaiiwisl.fquryqt
a14-87.smtp-out.amazonses.com
infb.tmes.trendmicro.com
mout2.freenet.de
bc68e72c6393.b3ta.com
bounce.earthlink.net
palmettocitizens.org
southmet.com
EUR01-VE1-obe.outbound.protection.outlook.com
tohefcu.org
email.mystatement.org
gaepd.org
threemkart.net
ussfcu.org
dal004.relay.arandomserver.com
smtp02.bitchute.com
edwardsfcu.org
notices.cascadecu.org
prod-plum-cormorant.itisonboxes.com
EUR04-DB3-obe.outbound.protection.outlook.com
cascadecu.org
northlandcu.com
ufirstcu.com
OS6P279CU014.outbound.protection.outlook.com
hdriver.org
heartlandcu.com
premieramerica.com
valleyfirst.com
Debian-bullseye-latest-amd64-base
mayocreditunion.org
mxr.mfg.siteprotect.com
lianza.org
princegeorgescfcu.org
memberonefcu.com
ahcu.coop
argentcu.org
blueoxcu.org
cheapvapeking.store
clamta09.bpe.bigpond.com
myqpwmgzzssxvdtnijpijjkqbgylaxhykwbdt.mtvdixh
smtp.digitalmailer.com
delivery.antispam.mailspamprotection.com
firstcommunityrealty.com
fremont.future-nine.com
vuphyofqssnzzygnuzcgtfbvxmiiypeoqpnrd.wjdnvkq
beaconcu.org
edelivery.americascu.org
gmail.com
roofinglakenorman.com
onpetfehaauyenctjiklagnotidxtwvfuqri.juptch
riverfallcu.com
NAM04-BN8-obe.outbound.protection.outlook.com
firstcommunity.com
lu2.hotelexecutive.com
a14-98.smtp-out.amazonses.com
ny005.relay.arandomserver.com
host1.absolutelystunningcenterpieces.com
a14-86.smtp-out.amazonses.com
orionfcu.com
islandsavings.ca
mail.caresetup.pro
memphiscu.org
agriculturefcu.org
radiantcu.org
EUR02-DB5-obe.outbound.protection.outlook.com
EUR04-VI1-obe.outbound.protection.outlook.com
rvgqtugzszfisqqqrzmzqnurmcdvbzyjnfsn.kaiafbr
smtp03.bitchute.com
membersheritage.org
mitfcu.mit.edu
olycu.org
psfcu.com
companypromotionalitems.net
firstcommercecu.org
lcfcu.org
stmarysbank.com
bpkqgepcygeuuymrwowzliywjuujwldyitkvsudn.jjqxb
chfcu.org
infirstfcu.org
zaion.org
NAM12-BN8-obe.outbound.protection.outlook.com
wellbyfinancial.com
fecca.com
mout0.freenet.de
mainesavings.com
prod-tomato-swan.itisonboxes.com
documentsportal.com
bounce.doximapps.com
nsewsolutions.com
doxim.com
GBR01-LO4-obe.outbound.protection.outlook.com
a14-90.smtp-out.amazonses.com
copypcv.org
salesup.com.mx
EUR05-AM6-obe.outbound.protection.outlook.com
democracyfcu.org
ficu.com
EUR05-VI1-obe.outbound.protection.outlook.com
NAM02-SN1-obe.outbound.protection.outlook.com
NAM12-DM6-obe.outbound.protection.outlook.com
digitalmailer.com
dortfcu.org
qualstarcu.com
smtp01.bitchute.com
twi.org.pl
NAM11-BN8-obe.outbound.protection.outlook.com
membersalliance.org
bayerhfcu.com
uniwyo.com
keysfcu.org
wvista.com
mail.otomobilyetkiliservis.com
reliablecredit.com
brumen.org
cob.org
cofcu.org
lax091.relay.arandomserver.com
EUR05-DB8-obe.outbound.protection.outlook.com
mvcu.com
cherishedrubies.store
henryschein.com
navigatorcu.org
0
Other IPs
Other IPs with the same hostname

The path to reputation greatness.

See if you’re being blocked.

Is your reputation suffering because you’re on a blocklist? Use our free tool to investigate.

Learn from star senders

Hear real sender stories on the Email After Hours podcast.

Keep your lists clean

Upload your list to our list quality checks tool to see if your contacts are legit.

Talk to an email expert.

We’re the experts in deliverability and driving maximum results from your email marketing. Let’s chat and find out how you can improve your sender reputation and raise your revenue.

Assess

Learn

Act