List Quality Check

You have no lists. To create a list click here

Select Page
Icon

Sender Score

Results for IP address
12.34.56.789

Sender Score

You have an "ok" reputation, but there's room for improvement. Continue to follow industry best practices and optimize your email program.

Sender Metrics

Hostname
-
Volume Sender Class   
-
Certified by Validity   
Return Path Safe   
Reputation Measures
Measure Impact on this score
  Blocklists LOW
  Complaints LOW
  Infrastructure LOW
  ISP Bulk Rate Contact us for details
  Message Filtered LOW
  Sender Rejected LOW
  Spam Traps 5
  Unknown Users LOW
Sending Domains
Domain
cjfcu.org
bestguide.store
bunting.drbellem.store
gcfcu.org
mout0.freenet.de
nymeo.org
palmettocitizens.org
NAM11-DM6-obe.outbound.protection.outlook.com
prod-plum-cormorant.itisonboxes.com
host1.absolutelystunningcenterpieces.com
smtp12.digitalmailer.com
elgacu.com
cob.org
fsbwa.com
chirojenny.store
a14-92.smtp-out.amazonses.com
lax064.relay.arandomserver.com
pscunow.com
doxim.com
firstcommercecu.org
lsfeguefphybbsazfvyiwjhaafflposdutsgi.lyfteh
ny021.relay.arandomserver.com
NAM02-BN1-obe.outbound.protection.outlook.com
digitalmailer.com
ejfhdgrgmoacgvizlunswyiohwoejjthsgce.pbfjfaj
NAM11-BN8-obe.outbound.protection.outlook.com
bc68e72c6393.b3ta.com
ffcocu.org
sumafcu.org
mout3.freenet.de
NAM12-MW2-obe.outbound.protection.outlook.com
atfcu.com
membersalliance.org
EUR04-VI1-obe.outbound.protection.outlook.com
wajldesign.com
newhcu.org
smtp11.digitalmailer.com
wvista.com
Debian-bullseye-latest-amd64-base
nextmarkcu.org
radiantcu.org
ezbhxilcksphwttgafmwcwctkegkfaiiwisl.fquryqt
lax092.relay.arandomserver.com
lax098.relay.arandomserver.com
mout1.freenet.de
riverfallcu.com
EUR05-DB8-obe.outbound.protection.outlook.com
childrenmoon.store
companypromotionalitems.net
documentsportal.com
edelivery.hartfordfcu.com
infb.tmes.trendmicro.com
safewayfcu.com
lax101.relay.arandomserver.com
worcestercu.com
dal010.relay.arandomserver.com
hdriver.org
ireland-bank.com
dimiel.store
caipbrvsuuqeakuozqljoegwrgxetwqcwuqpq.vzngqc
mayocreditunion.org
mout2.freenet.de
psfcu.com
NAM12-BN8-obe.outbound.protection.outlook.com
dovinoss.store
firstamerican.org
mystatement.org
zhioolxvsjvslkmjqjoypwcoefdafuijmtqs.zoufbp
GBR01-LO4-obe.outbound.protection.outlook.com
gccu.org
lcfcu.org
localhost.members.linode.com
mitfcu.mit.edu
mvcu.com
NAM04-DM6-obe.outbound.protection.outlook.com
childressdds.store
dal004.relay.arandomserver.com
hncu.org
apgfcu.com
cuadvantage.coop
notices.cascadecu.org
stmarysbank.com
NAM04-MW2-obe.outbound.protection.outlook.com
cascadecu.org
dirkschiro.store
regionalfcu.org
sgipkjmrfcjepjjeiwedxdgndnbdlccsidcz.sclhyio
threemkart.net
NAM04-BN8-obe.outbound.protection.outlook.com
keysfcu.org
orionfcu.com
vmi1690196.contaboserver.net
firstcommunityrealty.com
uniwyo.com
annette.wxwxsqsqazzdsedcvfdsqwxcvfdsqazerfdv.rtgfdsz
cofcu.org
dortfcu.org
heartlandcu.com
soundcu.com
ytvxyozrbngngyuurqwyyudxiyydtfgnmkzbu.fgvzerm
a14-87.smtp-out.amazonses.com
pyramidfcu.org
southmet.com
exhmta04.bpe.bigpond.com
edelivery.nextmarkcu.org
westcommunitycu.org
owfwc-chgo.org
edelivery.americascu.org
NAM02-DM3-obe.outbound.protection.outlook.com
signaturefcu.org
bestblog.store
democracyfcu.org
henryschein.com
NAM02-SN1-obe.outbound.protection.outlook.com
kid-alert.org
olycu.org
smart-guide.org
dxzzoocdwciwueqqqhgsbbqydksoobgbrvbm.mxhcbiw
firstcommunity.com
premieramerica.com
smtp02.bitchute.com
NAM12-DM6-obe.outbound.protection.outlook.com
a1cu.org
uecu.org
visionsfcu.org
NAM11-CO1-obe.outbound.protection.outlook.com
email.mystatement.org
infirstfcu.org
smtp01.bitchute.com
agriculturefcu.org
a14-81.smtp-out.amazonses.com
a14-96.smtp-out.amazonses.com
membersheritage.org
shellfcu.org
NAM10-MW2-obe.outbound.protection.outlook.com
tohefcu.org
waunafcu.org
divanine.store
pkqftgfvvzsptmgnutyslvdcsomtbjuoulhlwntr.ptjtb
bankcfcu.org
bayerhfcu.com
mypensacolacu.com
smtp.digitalmailer.com
GVZP280CU001.outbound.protection.outlook.com
bestcash.store
besteasy.store
bounce.doximapps.com
mx0b-0036e702.pphosted.com
unitedlocal.org
dimercont.store
firstcoastccu.com
fremont.future-nine.com
members.leadersemail.com
mxr.mfg.siteprotect.com
navigatorcu.org
prod-tomato-swan.itisonboxes.com
chicksnest.store
reliablecredit.com
palisadesfcu.org
NAM10-BN7-obe.outbound.protection.outlook.com
dal007.relay.arandomserver.com
lu2.hotelexecutive.com
cherithpaisley.store
memphiscu.org
abcofcu.org
tandsgo2.backslash.host
lax091.relay.arandomserver.com
smtp03.bitchute.com
valleyfirst.com
northlandcu.com
toplinecu.com
ukfcu.org
advfinfcu.com
chfcu.org
docfcu.org
princegeorgescfcu.org
brri.org
edelivery.bloomcu.org
trueccu.com
dia.org.au
edwardsfcu.org
mainesavings.com
prod-wheat-hummingbird.itisonboxes.com
safefed.org
codecu.org
mail1.euroasiaconferences.com
memberonefcu.com
copypcv.org
nefcu.com
ussfcu.org
edelivery.docfcu.org
EUR04-DB3-obe.outbound.protection.outlook.com
americanspiritfcu.org
argentcu.org
diswy.store
myconservativeview.com
starautism.biz
wellbyfinancial.com
EUR05-VI1-obe.outbound.protection.outlook.com
NAM10-DM6-obe.outbound.protection.outlook.com
fax.earthlinkbusiness.com
fecca.com
nufufesvxeltoberqwwonqilvoqabhuhjljv.cyxdnyg
merckefcu.com
ahcu.coop
beaconcu.org
blueoxcu.org
mar-search.org
qualstarcu.com
ufirstcu.com
ywpkziptjjnsyjpnhxitiiawpwyeimbduplwd.vowmko
EUR05-AM6-obe.outbound.protection.outlook.com
0
Other IPs
Other IPs with the same hostname

The path to reputation greatness.

See if you’re being blocked.

Is your reputation suffering because you’re on a blocklist? Use our free tool to investigate.

Learn from star senders

Hear real sender stories on the Email After Hours podcast.

Keep your lists clean

Upload your list to our list quality checks tool to see if your contacts are legit.

Talk to an email expert.

We’re the experts in deliverability and driving maximum results from your email marketing. Let’s chat and find out how you can improve your sender reputation and raise your revenue.

Assess

Learn

Act