SSL Information
Sending IPs
IP Address | Hostname | Volume | Sender Score |
---|---|---|---|
94.143.106.103 | teamvelocity1.mta.dotmailer.com. | VERY HIGH | 97 |
94.143.106.238 | teamvelocity2.mta.dotmailer.com. | VERY HIGH | 99 |
Related Sending Domains
MX Record
A form of authentication that specifies whether an MX, or mail exchange, record is specified for this domain. The MX record identifies the mail server that is responsible for handling emails of a specific domain name.
SPF Record
SPF is an email authentication protocol designed to verify that each email originates from the Internet domain from which it claims to come based on the sender's IP address.
IP Address
A list of the IP addresses that we have seen sending mail for this domain.
Volume
Based on the number of emails seen by our reputation network in the last 30 days, this is the volume categorization of each IP address that we have seen sending mail for this domain.
Sender Score
A Sender Score is assigned to each IP and is a numerical representation of the IP address's reputation as a sender of mail. The score is determined by factoring performance across key reputation measures important to both ISPs and recipients of email. Sender Scores are on a scale of zero to 100, with zero being the worst score and 100 being the best score.
Other IPs
Other IPs we have seen that map to the hostname.
Whois Lookup
Let's check your score
Checking Sender Score for address:
email.jeffwylerfairfieldkiaspecials.com
Additional Information
The path to reputation greatness.
See if you’re being blocked.
Is your reputation suffering because you’re on a blocklist? Use our free tool to investigate.
Keep your lists clean
Upload your list to our list quality checks tool to see if your contacts are legit.
Talk to an email expert.
We’re the experts in deliverability and driving maximum results from your email marketing. Let’s chat and find out how you can improve your sender reputation and raise your revenue.